PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009151519.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 326aa    MW: 37809.5 Da    PI: 10.1372
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009151519.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.39.5e-26197245452
          RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      + ledlskyF  pi +A+++L+v+lTvLK++CR++GI+RWPhRkiksl
  XP_009151519.1 197 GLCLEDLSKYFGVPIVEASRKLNVGLTVLKKKCREFGIPRWPHRKIKSL 245
                     5779*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.099180265IPR003035RWP-RK domain
PfamPF020421.1E-21198245IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MAHSLTSLAI FQGVNHKEMI RSLHVYGSVE IEREFLFERK GRYVEKKAKP LFCSEGLQRP  60
EISLGLVFGT WRCIFLFRSN HSLPQFPTLL CPSRNPKLVD IPNLANVLKF ISELKPKKPY  120
FDQPKQLDLV VKEDRVGYGE VDQAKPQRFA LKQDLNRLPD SESESEESED DQNEHSESDA  180
KTEILKKRRT PSQHVAGLCL EDLSKYFGVP IVEASRKLNV GLTVLKKKCR EFGIPRWPHR  240
KIKSLDSLIH DLQEEAEKQQ EKNKAAAMVV AKKQKKLERE MRNIVERPFM EIQIETKRFR  300
QDNFKKRHRA SRAKKNQESL ATSSST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0311352e-75AL031135.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F8D20 (ESSAII project).
GenBankAL1615872e-75AL161587.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 83.
GenBankCP0026872e-75CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151519.10.0PREDICTED: protein RKD5
SwissprotO817911e-168RKD5_ARATH; Protein RKD5
TrEMBLM4D5690.0M4D569_BRARP; Uncharacterized protein
STRINGBra011626.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM120492429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-138RWP-RK domain-containing protein